PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00019926001
Common NameGSBRNA2T00019926001, LOC106433942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8306 Da    PI: 10.7312
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00019926001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA134.42.8e-42976370
                 S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                         +a++eakGlnPGlivllv+g +l+ flv+ny++yvyaqknlPPrkkkPvskkklkreklkqGv+vPGe
  GSBRNA2T00019926001  9 KAAAEAKGLNPGLIVLLVIGVPLVGFLVANYVMYVYAQKNLPPRKKKPVSKKKLKREKLKQGVSVPGE 76
                         7899***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046894.5E-371276IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MDGEDFARKA AAEAKGLNPG LIVLLVIGVP LVGFLVANYV MYVYAQKNLP PRKKKPVSKK  60
KLKREKLKQG VSVPGE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.119861e-112seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892693e-92AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013730236.16e-47PREDICTED: DNA-binding protein S1FA1-like
RefseqXP_013600217.16e-47PREDICTED: DNA-binding protein S1FA1
SwissprotQ423373e-20S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A078J2Z06e-47A0A078J2Z0_BRANA; BnaCnng30990D protein
STRINGBra006994.1-P2e-29(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53370.12e-06S1FA-like DNA-binding protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]